General Information

  • ID:  hor006833
  • Uniprot ID:  O14604
  • Protein name:  Thymosin beta-4
  • Gene name:  LHB
  • Organism:  Homo sapiens
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  Ubiquitous
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton
  • GO BP:  GO:0003785 actin monomer binding
  • GO CC:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0008064 regulation of actin polymerization or depolymerization; GO:0042989 sequestering of actin monomers

Sequence Information

  • Sequence:  SDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
  • Length:  43
  • Propeptide:  MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA